219482 Sigma-AldrichCaveolin-1 Scaffolding Domain Peptide, Cell-permeable - Calbiochem
Caveolin-1 Scaffolding Domain Peptide, Cell-permeable, blocks eNOS activity and cellular NO release in vitro and reduces inflammation and tumorigenesis in vivo.
More>> Caveolin-1 Scaffolding Domain Peptide, Cell-permeable, blocks eNOS activity and cellular NO release in vitro and reduces inflammation and tumorigenesis in vivo. Less<<Synonyme: AP-Cav, Pen-C1-SD, RQIKIWFQNRRMKWKK-DGIWKASFTTFTVTKYWFYR, Cavtratin
Empfohlene Produkte
Übersicht
Replacement Information |
---|
Key Spec Table
Empirical Formula |
---|
C₂₂₈H₃₃₅N₆₁O₄₉S |
Preis & Verfügbarkeit
Bestellnummer | Verfügbarkeit | Verpackung | St./Pkg. | Preis | Menge | |
---|---|---|---|---|---|---|
219482-1MG |
|
Kst.-Ampulle | 1 mg |
|
— |
Product Information | |
---|---|
ATP Competitive | N |
Form | White lyophilized solid |
Formulation | Supplied as a trifluoroacetate salt. |
Hill Formula | C₂₂₈H₃₃₅N₆₁O₄₉S |
Chemical formula | C₂₂₈H₃₃₅N₆₁O₄₉S |
Hygroscopic | Hygroscopic |
Reversible | N |
Quality Segment | MQ100 |
Applications | |
---|---|
Application | Caveolin-1 Scaffolding Domain Peptide, Cell-permeable, blocks eNOS activity and cellular NO release in vitro and reduces inflammation and tumorigenesis in vivo. |
Biological Information | |
---|---|
Primary Target | eNOS |
Purity | ≥95% by HPLC |
Dimensions |
---|
Materials Information |
---|
Toxicological Information |
---|
Safety Information according to GHS |
---|
Safety Information |
---|
Product Usage Statements |
---|
Packaging Information | |
---|---|
Packaged under inert gas | Packaged under inert gas |
Transport Information |
---|
Supplemental Information |
---|
Specifications |
---|
Global Trade ITEM Number | |
---|---|
Bestellnummer | GTIN |
219482-1MG | 04055977218565 |
Documentation
Caveolin-1 Scaffolding Domain Peptide, Cell-permeable - Calbiochem SDB
Titel |
---|
Caveolin-1 Scaffolding Domain Peptide, Cell-permeable - Calbiochem Analysenzertifikate
Titel | Chargennummer |
---|---|
219482 |
Literatur
Übersicht |
---|
Bernatchez, P.N., et al. 2005. Proc. Natl. Acad. Sci. USA 102, 761. Williams, T.M., et al. 2004. J. Biol. Chem. 279, 51630. Gratton, J.P., et al. 2003. Cancer Cell 4, 31. Sukumaran, S.K., et al. 2002. J. Biol. Chem. 277, 50716. Liu, J., et al. 2002. J. Biol. Chem. 277, 10661. Bucci, M., et al. 2000. Nat. Med. 6, 1362. Okamoto, T., et al. 1998. J. Biol. Chem. 273, 5419. |