171596 Sigma-Aldrichβ-Amyloid Peptide (1-42), Rat
Predominant peptide found in the brain of patients with Alzheimer's Disease and Down's Syndrome. Promotes down-regulation of Bcl-2 and upregulation of Bax expression in neurons.
More>> Predominant peptide found in the brain of patients with Alzheimer's Disease and Down's Syndrome. Promotes down-regulation of Bcl-2 and upregulation of Bax expression in neurons. Less<<Sinonimi: DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
Prodotti consigliati
Panoramica
Replacement Information |
---|
Prezzi e disponibilità
Numero di catalogo | Disponibilità | Confezionamento | Qtà/conf | Prezzo | Quantità | |
---|---|---|---|---|---|---|
171596-250UG |
|
Fiala di plastica | 250 μg |
|
— |
Product Information | |
---|---|
CAS number | 107761-42-2 |
Form | Lyophilized |
Formulation | Supplied as a trifluoroacetate salt. |
Hill Formula | C₁₉₉H₃₀₇N₅₃O₅₉S |
Chemical formula | C₁₉₉H₃₀₇N₅₃O₅₉S |
Hygroscopic | Hygroscopic |
Quality Segment | MQ100 |
Applications |
---|
Biological Information | |
---|---|
Purity | ≥80% by HPLC |
Dimensions |
---|
Materials Information |
---|
Toxicological Information |
---|
Safety Information according to GHS |
---|
Safety Information |
---|
Product Usage Statements |
---|
Packaging Information |
---|
Transport Information |
---|
Supplemental Information |
---|
Specifications |
---|
Global Trade ITEM Number | |
---|---|
Numero di catalogo | GTIN |
171596-250UG | 04055977207286 |
Documentation
β-Amyloid Peptide (1-42), Rat MSDS
Titolo |
---|
β-Amyloid Peptide (1-42), Rat Certificati d'Analisi
Titolo | Numero di lotto |
---|---|
171596 |
Riferimenti bibliografici
Panoramica delle referenze |
---|
Paradis, E., et al. 1996. J. Neurosci. 16, 7533. Roher, A.E., et al. 1996. J. Biol. Chem. 271, 20631. Soto, C., and Castano, E.M. 1996. Biochem. J. 314, 701. Murrell, J., et al. 1991. Science 254, 97. Goldgaber, D., et al. 1987. Science 235, 877. Kang, J., et al. 1987. Nature 325, 733. |
Brochure
Titolo |
---|
Alzheimer's Disease Brochure & Technical Guide |