Millipore Sigma Vibrant Logo

06-847-25UG Anti-EGFR (rabbit polyclonal IgG)

View Products on Sigmaaldrich.com
06-847-25UG
25 μg  
Retrieving price...
Price could not be retrieved
Minimum Quantity is a multiple of
Maximum Quantity is
Upon Order Completion More Information
You Saved ()
 
Request Pricing
Fulfillment and delivery delayed
Fulfillment and delivery delayed
In Stock 
Discontinued
Limited Quantities Available
Availability to be confirmed
    Remaining : Will advise
      Remaining : Will advise
      Will advise
      Contact Customer Service
      Contact Customer Service

      Special Offers

       

      Contact Customer Service

      Overview

      Replacement Information

      Key Spec Table

      Species ReactivityKey ApplicationsHostFormatAntibody Type
      H, M, R, HtIP, WBRbPurifiedPolyclonal Antibody
      Description
      Catalogue Number06-847-25UG
      Brand Family Upstate
      Trade Name
      • Upstate
      DescriptionAnti-EGFR (rabbit polyclonal IgG)
      Alternate Names
      • Receptor tyrosine-protein kinase ErbB-1
      • avian erythroblastic leukemia viral (v-erb-b) oncogene homolog
      • cell growth inhibiting protein 40
      • cell proliferation-inducing protein 61
      • epidermal growth factor receptor
      • epidermal growth factor receptor (avian erythroblastic leukemia viral
        (v-erb-b) oncogene homolog)
      • epidermal growth factor receptor (erythroblastic leukemia viral (v-erb-b) oncogene homolog, avian)
      Background InformationThe epidermal growth factor receptor (EGFR; ErbB-1; HER1 in humans) is the cell-surface receptor for members of the epidermal growth factor family (EGF-family) of extracellular protein ligands. The epidermal growth factor receptor is a member of the ErbB family of receptors, a subfamily of four closely related receptor tyrosine kinases: EGFR (ErbB-1), HER2/c-neu (ErbB-2), Her 3 (ErbB-3) and Her 4 (ErbB-4). Mutations affecting EGFR expression or activity could result in cancer. EGFR (epidermal growth factor receptor) exists on the cell surface and is activated by binding of its specific ligands, including epidermal growth factor and transforming growth factor α (TGFα). Upon activation by its growth factor ligands, EGFR undergoes a transition from an inactive monomeric form to an active homodimer. In addition to forming homodimers after ligand binding, EGFR may pair with another member of the ErbB receptor family, such as ErbB2/Her2/neu, to create an activated heterodimer. EGFR dimerization stimulates its intrinsic intracellular protein-tyrosine kinase activity. As a result, autophosphorylation of five tyrosine (Y) residues in the C-terminal domain of EGFR occurs.
      References
      Product Information
      FormatPurified
      Control
      • A431 cell lysate, human cervical carcinoma.

        Included Positive Antigen Control:
        Catalog # 12-305, 3T3/A31 Cell Lysate. Add 2.5 µL of 2-mercaptoethanol/100 µL of lysate and boil for 5 minutes to reduce the preparation. Load 20 µg of reduced lysate per lane for minigels.
      PresentationPurified rabbit polyclonal IgG in buffer containing 0.1M Tris-Glycine, 0.15M NaCl, 0.05% Sodium Azide, pH 7.4. Store at 2-8°C.
      Quality SegmentMQ100
      Applications
      ApplicationAnti-EGFR Antibody detects level of EGFR & has been published & validated for use in IP & WB.
      Key Applications
      • Immunoprecipitation
      • Western Blotting
      Application NotesImmunoprecipitation:
      4 µg of a previous lot immunoprecipitated the EGFR from 500 µg of a 3T3/A31 RIPA cell lysate.
      Immunohistochemistry (Paraffin) Analysis: A 1:500 dilution of this antibody detected EGFR in human placenta tissue sections.
      Biological Information
      ImmunogenOvalbumin conjugated synthetic peptide (ETKPNGIFKGPTAENAEYLRVAPPSSEFIGA) corresponding to amino acids 1156-1186 of the processed mouse EGF receptor (EGFR) C-terminal domain (Accession number Q01279). The immunizing sequence shares 28/31 identity with the human EGF receptor sequence.
      ConcentrationPlease refer to lot specific datasheet.
      HostRabbit
      SpecificityRecognizes the EGFR, Mr 180 kDa.
      IsotypeIgG
      Species Reactivity
      • Human
      • Mouse
      • Rat
      • Hamster
      Species Reactivity NoteMouse and human. Reported to detect rat and hamster.
      Antibody TypePolyclonal Antibody
      Entrez Gene Number
      Entrez Gene SummaryThe protein encoded by this gene is a transmembrane glycoprotein that is a member of the protein kinase superfamily. This protein is a receptor for members of the epidermal growth factor family. EGFR is a cell surface protein that binds to epidermal growth factor. Binding of the protein to a ligand induces receptor dimerization and tyrosine autophosphorylation and leads to cell proliferation. Mutations in this gene are associated with lung cancer. [provided by RefSeq]
      Gene Symbol
      • EGFR
      • ERBB1
      • ERBB
      • mENA
      Purification MethodProtein A chromatography
      UniProt Number
      UniProt SummaryFUNCTION: SwissProt: P00533 # Isoform 2/truncated isoform may act as an antagonist.
      SIZE: 1210 amino acids; 134277 Da
      SUBUNIT: Binds RIPK1. CBL interacts with the autophosphorylated C- terminal tail of the EGF receptor. Part of a complex with ERBB2 and either PIK3C2A or PIK3C2B. The autophosphorylated form interacts with PIK3C2B, maybe indirectly. Interacts with PELP1.
      SUBCELLULAR LOCATION: Cell membrane; Single-pass type I membrane protein. & Isoform 2: Secreted.
      TISSUE SPECIFICITY: Expressed in placenta. Isoform 2 is also expressed in ovarian cancers.
      PTM: Phosphorylation of Ser-695 is partial and occurs only if Thr- 693 is phosphorylated. & Monoubiquitinated and polyubiquitinated upon EGF stimulation; which does not affect tyrosine kinase activity or signaling capacity but may play a role in lysosomal targeting. Polyubiquitin linkage is mainly through 'Lys-63', but linkage through 'Lys-48', 'Lys-11' and 'Lys-29' also occur.DISEASE:SwissProt: P00533 # Defects in EGFR are associated with lung cancer [MIM:211980].
      SIMILARITY: SwissProt: P00533 ## Belongs to the protein kinase superfamily. Tyr protein kinase family. EGF receptor subfamily. & Contains 1 protein kinase domain.
      MISCELLANEOUS: Binding of EGF to the receptor leads to dimerization, internalization of the EGF-receptor complex, induction of the tyrosine kinase activity, stimulation of cell DNA synthesis, and cell proliferation.
      Molecular Weight180 kDa
      Physicochemical Information
      Dimensions
      Materials Information
      Toxicological Information
      Safety Information according to GHS
      Safety Information
      Product Usage Statements
      Quality AssuranceRoutinely evaluated by western blot on a mouse 3T3/A31 RIPA cell lysate.

      Western Blot Analysis:
      0.5-2 µg/mL of this lot detected the EGFR from a mouse 3T3/A31 RIPA cell lysate.
      Usage Statement
      • Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
      Storage and Shipping Information
      Storage ConditionsStable for 1 year at 2-8°C from date of receipt.

      Handling Recommendations: Upon first thaw,
      and prior to removing the cap, centrifuge the
      vial and gently mix the solution.
      Packaging Information
      Material Size25 μg
      Transport Information
      Supplemental Information
      Specifications
      Global Trade ITEM Number
      Catalogue Number GTIN
      06-847-25UG 04054839337475