171596 Sigma-Aldrichβ-Amyloid Peptide (1-42), Rat
Predominant peptide found in the brain of patients with Alzheimer's Disease and Down's Syndrome. Promotes down-regulation of Bcl-2 and upregulation of Bax expression in neurons.
More>> Predominant peptide found in the brain of patients with Alzheimer's Disease and Down's Syndrome. Promotes down-regulation of Bcl-2 and upregulation of Bax expression in neurons. Less<<Synonymes: DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
Produits recommandés
Aperçu
Replacement Information |
---|
Prix & Disponibilité
Référence | Disponibilité | Conditionnement | Qté | Prix | Quantité | |
---|---|---|---|---|---|---|
171596-250UG |
|
Ampoule plast. | 250 μg |
|
— |
Product Information | |
---|---|
CAS number | 107761-42-2 |
Form | Lyophilized |
Formulation | Supplied as a trifluoroacetate salt. |
Hill Formula | C₁₉₉H₃₀₇N₅₃O₅₉S |
Chemical formula | C₁₉₉H₃₀₇N₅₃O₅₉S |
Hygroscopic | Hygroscopic |
Quality Segment | MQ100 |
Applications |
---|
Biological Information | |
---|---|
Purity | ≥80% by HPLC |
Dimensions |
---|
Materials Information |
---|
Toxicological Information |
---|
Safety Information according to GHS |
---|
Safety Information |
---|
Product Usage Statements |
---|
Packaging Information |
---|
Transport Information |
---|
Supplemental Information |
---|
Specifications |
---|
Global Trade ITEM Number | |
---|---|
Référence | GTIN |
171596-250UG | 04055977207286 |
Documentation
β-Amyloid Peptide (1-42), Rat FDS
Titre |
---|
β-Amyloid Peptide (1-42), Rat Certificats d'analyse
Titre | Numéro de lot |
---|---|
171596 |
Références bibliographiques
Aperçu de la référence bibliographique |
---|
Paradis, E., et al. 1996. J. Neurosci. 16, 7533. Roher, A.E., et al. 1996. J. Biol. Chem. 271, 20631. Soto, C., and Castano, E.M. 1996. Biochem. J. 314, 701. Murrell, J., et al. 1991. Science 254, 97. Goldgaber, D., et al. 1987. Science 235, 877. Kang, J., et al. 1987. Nature 325, 733. |
Brochure
Titre |
---|
Alzheimer's Disease Brochure & Technical Guide |