508514 Sigma-AldrichPsalmotoxin-1 - CAS 316808-68-1 - Calbiochem
A potent proton-gated sodium channel (ASIC1a) channel blocking neurotoxin (IC₅₀ = 0.9 nM) that can distinguish between the two ASIC1 splice variants, ASIC1a and ASIC1b.
More>> A potent proton-gated sodium channel (ASIC1a) channel blocking neurotoxin (IC₅₀ = 0.9 nM) that can distinguish between the two ASIC1 splice variants, ASIC1a and ASIC1b. Less<<Synonyms: ASIC1a Inhibitor, Psalmotoxin 1
Recommended Products
Overview
Replacement Information |
---|
Key Spec Table
CAS # | Empirical Formula |
---|---|
316808-68-1 | C₂₀₀H₃₁₂N₆₂O₅₇S₆ |
Pricing & Availability
Catalogue Number | Availability | Packaging | Qty/Pack | Price | Quantity | |
---|---|---|---|---|---|---|
5.08514.0001 |
|
Botol kaca | 20 μg |
|
— |
References | |
---|---|
References | Qadri, Y. J. et al. 2009. J. Biol. Chem. 284, 17625. M. Mazzuca, et al. 2007. Nat Neurosci. 10, 943. Escoubas, P. et al. 2000. J. Biol. Chem. 275, 25116. |
Product Information | |
---|---|
CAS number | 316808-68-1 |
Form | Colorless semi-solid to viscous liquid |
Hill Formula | C₂₀₀H₃₁₂N₆₂O₅₇S₆ |
Chemical formula | C₂₀₀H₃₁₂N₆₂O₅₇S₆ |
Hygroscopic | Hygroscopic |
Quality Segment | MQ100 |
Applications |
---|
Biological Information | |
---|---|
Primary Target | ASIC1a |
Primary Target IC<sub>50</sub> | 0.9 nM |
Purity | ≥94% by HPLC |
Physicochemical Information | |
---|---|
Peptide Sequence | EDCIPKWKGCVNRHGDCCEGLECWKRRRSFEVCVPKTPKT (disulfide bond 3-18, 10-23, 17-33) |
Dimensions |
---|
Materials Information |
---|
Toxicological Information |
---|
Safety Information according to GHS |
---|
Safety Information |
---|
Product Usage Statements |
---|
Packaging Information |
---|
Transport Information |
---|
Supplemental Information |
---|
Specifications |
---|
Global Trade ITEM Number | |
---|---|
Catalogue Number | GTIN |
5.08514.0001 | 04055977262056 |
Documentation
Psalmotoxin-1 - CAS 316808-68-1 - Calbiochem MSDS
Title |
---|
References
Reference overview |
---|
Qadri, Y. J. et al. 2009. J. Biol. Chem. 284, 17625. M. Mazzuca, et al. 2007. Nat Neurosci. 10, 943. Escoubas, P. et al. 2000. J. Biol. Chem. 275, 25116. |