Saltar al contenido
Merck

HPA001204

Anti-STX17 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Sinónimos:

Anti-KAT01814 antibody produced in rabbit, Anti-Syntaxin-17 antibody produced in rabbit

Iniciar sesión para ver los precios por organización y contrato.

Seleccione un Tamaño

Cambiar Vistas

Acerca de este artículo

UNSPSC Code:
12352203
NACRES:
NA.41
Human Protein Atlas Number:
Conjugate:
unconjugated
Clone:
polyclonal
Application:
IHC
Citations:
45
Servicio técnico
¿Necesita ayuda? Nuestro equipo de científicos experimentados está aquí para ayudarle.
Permítanos ayudarle


biological source

rabbit

Quality Segment

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

enhanced validation

RNAi knockdown
Learn more about Antibody Enhanced Validation

technique(s)

immunoblotting: 0.04-0.4 μg/mL, immunohistochemistry: 1:200-1:500

immunogen sequence

RLEPAIQKFIKIVIPTDLERLRKHQINIEKYQRCRIWDKLHEEHINAGRTVQQLRSNIREIEKLCLKVRKDDLVLLKRMIDPVKEEASAATAEFLQLHLESVEELKKQFNDEETLLQPPLTRSMTVGGAFHTTEAEASSQSLTQ

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... STX17(55014)

General description

Syntaxin 17 (Stx17) is an autophagosomal SNARE (soluble N-ethylmaleimide-sensitive factor attachment protein receptor) protein. STX17 is a member of the syntaxin family and is located on human chromosome 9q31. It is stored in the cytosol.

Immunogen

Syntaxin-17 recombinant protein epitope signature tag (PrEST)

Application

Anti-STX17 antibody has been used:
  • in SNARE (soluble N-ethylmaleimide-sensitive factor attachment protein receptor) protein reconstitution
  • in immunoelectron microscopy
  • to investigate its relevance to the hepatitis C virus (HCV) life cycle and, thereby, to reveal the role of autophagosome-lysosome fusion for the turnover of viral particles

Anti-STX17 antibody produced in rabbit is suitable for co-immunoprecipitation.
Anti-STX17 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Biochem/physiol Actions

Syntaxin 17 (STX17) is an autophagosomal SNARE (soluble N-ethylmaleimide–sensitive factor attachment protein receptors) that in involved in fusion with the endosome/lysosome. It is mostly localized to the ER and to some extent in the ER-Golgi intermediate compartment (ERGIC). It may function as a receptor at the ER membrane that is involved in the trafficking between the ER and post-ER compartments. It cycles between ER and ERGIC via pathways involving COPII and COPI (coatomer protein I) vesicle. The protein is required for the maintenance of ERGIC and Golgi architecture.
Syntaxin 17 (Stx17) encodes membrane proteins, that participates in synaptic vesicle fusion.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Other Notes

Corresponding Antigen APREST79900

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.


Still not finding the right product?

Pruebe nuestra Herramienta de selección de productos para limitar sus opciones


Clase de almacenamiento

10 - Combustible liquids

wgk

WGK 1

ppe

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)



Elija entre una de las versiones más recientes:

Certificados de análisis (COA)

Lot/Batch Number

¿No ve la versión correcta?

Si necesita una versión concreta, puede buscar un certificado específico por el número de lote.

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos