Millipore Sigma Vibrant Logo

198800 BeKm-1, Mesobuthus eupeus, Recombinant, E. coli

198800
  
Recuperando precio...
No pudo obtenerse el precio
La cantidad mínima tiene que ser múltiplo de
Maximum Quantity is
Al finalizar el pedido Más información
Ahorró ()
 
Solicitar precio
Disponibilidad a confirmar
Disponibilidad a confirmar
En existencia 
Suspendido
Cantidades limitadas disponibles
Debe confirmarse disponibilidad
    El resto: se avisará
      El resto: se avisará
      Se avisará
      Póngase en contacto con el Servicio de Atención al Cliente
      Contact Customer Service

       

      Póngase en contacto con el Servicio de Atención al Cliente

      Descripción

      Replacement Information

      Tabla espec. clave

      Empirical Formula
      C₁₇₄H₂₆₆N₅₁O₅₁S₆
      Description
      Overview

      This product has been discontinued.





      Recombinant, Mesobuthus eupeus BeKm-1 expressed in E. coli. Specifically blocks ERG1 K+ channels (IC50 = 3.3 nM).
      Catalogue Number198800
      Brand Family Calbiochem®
      SynonymsPeptide Inhibitor of M-type K+ Current, RPTDIKCSESYQCFPVCKSRFGKTNGRCVNGFCDCF
      References
      ReferencesKorolkova, Y.V., et al. 2001. J. Biol. Chem. 276, 9868.
      Filippov, A.K., et al. 1996. FEBS Lett. 384, 277.
      Product Information
      ATP CompetitiveN
      FormLyophilized
      Hill FormulaC₁₇₄H₂₆₆N₅₁O₅₁S₆
      Chemical formulaC₁₇₄H₂₆₆N₅₁O₅₁S₆
      Hygroscopic Hygroscopic
      ReversibleN
      Applications
      Biological Information
      Primary TargetERG1 K+ channels
      Primary Target IC<sub>50</sub>3.3 nM against ERG1 K+ channels
      Purity≥98% by HPLC
      Physicochemical Information
      Cell permeableN
      Peptide SequenceH-Arg-Pro-Thr-Asp-Ile-Lys-Cys⁷-Ser-Glu-Ser-Tyr-Gln-Cys¹³-Phe-Pro-Val-Cys¹⁷-Lys-Ser-Arg-Phe-Gly-Lys-Thr-Asn-Gly-Arg-Cys²⁸-Val-Asn-Gly-Phe-Cys³³-Asp-Cys³⁵-Phe-OH Disulfide bonds: Cys⁷ → Cys²⁸; Cys¹³ → Cys³³; Cys¹⁷ → Cys³⁵
      Dimensions
      Materials Information
      Toxicological Information
      Safety Information according to GHS
      Safety Information
      R PhraseR: 20/21/22

      Harmful by inhalation, in contact with skin and if swallowed.
      S PhraseS: 36

      Wear suitable protective clothing.
      Product Usage Statements
      Storage and Shipping Information
      Ship Code Ambient Temperature Only
      Toxicity Harmful
      Storage -20°C
      Hygroscopic Hygroscopic
      Do not freeze Ok to freeze
      Special InstructionsFollowing reconstitution aliquot and freeze (-20°C). Stock solutions are stable for up to 3 months at -20°C.
      Packaging Information
      Transport Information
      Supplemental Information
      Specifications
      Global Trade ITEM Number
      Número de referencia GTIN
      198800 0

      Documentation

      BeKm-1, Mesobuthus eupeus, Recombinant, E. coli Certificados de análisis

      CargoNúmero de lote
      198800

      Referencias bibliográficas

      Visión general referencias
      Korolkova, Y.V., et al. 2001. J. Biol. Chem. 276, 9868.
      Filippov, A.K., et al. 1996. FEBS Lett. 384, 277.
      Ficha técnica

      Note that this data sheet is not lot-specific and is representative of the current specifications for this product. Please consult the vial label and the certificate of analysis for information on specific lots. Also note that shipping conditions may differ from storage conditions.

      Revision28-April-2008 RFH
      SynonymsPeptide Inhibitor of M-type K+ Current, RPTDIKCSESYQCFPVCKSRFGKTNGRCVNGFCDCF
      DescriptionRecombinant, Mesobuthus eupeus BeKm-1 expressed in E. coli. Specifically blocks ERG1 K+ channels (IC50 = 3.3 nM). Reported to exhibit properties similar to that of the native toxin.
      FormLyophilized
      Chemical formulaC₁₇₄H₂₆₆N₅₁O₅₁S₆
      Peptide SequenceH-Arg-Pro-Thr-Asp-Ile-Lys-Cys⁷-Ser-Glu-Ser-Tyr-Gln-Cys¹³-Phe-Pro-Val-Cys¹⁷-Lys-Ser-Arg-Phe-Gly-Lys-Thr-Asn-Gly-Arg-Cys²⁸-Val-Asn-Gly-Phe-Cys³³-Asp-Cys³⁵-Phe-OH Disulfide bonds: Cys⁷ → Cys²⁸; Cys¹³ → Cys³³; Cys¹⁷ → Cys³⁵
      Purity≥98% by HPLC
      SolubilityAqueous buffers (4.3 µg/ml)
      Storage -20°C
      Hygroscopic
      Do Not Freeze Ok to freeze
      Special InstructionsFollowing reconstitution aliquot and freeze (-20°C). Stock solutions are stable for up to 3 months at -20°C.
      Toxicity Harmful
      ReferencesKorolkova, Y.V., et al. 2001. J. Biol. Chem. 276, 9868.
      Filippov, A.K., et al. 1996. FEBS Lett. 384, 277.