219482 Sigma-AldrichCaveolin-1 Scaffolding Domain Peptide, Cell-permeable - Calbiochem
Caveolin-1 Scaffolding Domain Peptide, Cell-permeable, blocks eNOS activity and cellular NO release in vitro and reduces inflammation and tumorigenesis in vivo.
More>> Caveolin-1 Scaffolding Domain Peptide, Cell-permeable, blocks eNOS activity and cellular NO release in vitro and reduces inflammation and tumorigenesis in vivo. Less<<Sinónimos: AP-Cav, Pen-C1-SD, RQIKIWFQNRRMKWKK-DGIWKASFTTFTVTKYWFYR, Cavtratin
Productos recomendados
Descripción
| Replacement Information |
|---|
Tabla espec. clave
| Empirical Formula |
|---|
| C₂₂₈H₃₃₅N₆₁O₄₉S |
Precios y disponibilidad
| Número de referencia | Disponiblidad | Embalaje | Cant./Env. | Precio | Cantidad | |
|---|---|---|---|---|---|---|
| 219482-1MG |
|
Ampolla de plást. | 1 mg |
|
— |
| Product Information | |
|---|---|
| ATP Competitive | N |
| Form | White lyophilized solid |
| Formulation | Supplied as a trifluoroacetate salt. |
| Hill Formula | C₂₂₈H₃₃₅N₆₁O₄₉S |
| Chemical formula | C₂₂₈H₃₃₅N₆₁O₄₉S |
| HS Code | 2933 99 99 |
| Hygroscopic | Hygroscopic |
| Reversible | N |
| Quality Segment | MQ100 |
| Applications | |
|---|---|
| Application | Caveolin-1 Scaffolding Domain Peptide, Cell-permeable, blocks eNOS activity and cellular NO release in vitro and reduces inflammation and tumorigenesis in vivo. |
| Biological Information | |
|---|---|
| Primary Target | eNOS |
| Purity | ≥95% by HPLC |
| Dimensions |
|---|
| Materials Information |
|---|
| Toxicological Information |
|---|
| Safety Information according to GHS |
|---|
| Safety Information |
|---|
| Product Usage Statements |
|---|
| Packaging Information | |
|---|---|
| Packaged under inert gas | Packaged under inert gas |
| Transport Information |
|---|
| Supplemental Information |
|---|
| Specifications |
|---|
| Global Trade ITEM Number | |
|---|---|
| Número de referencia | GTIN |
| 219482-1MG | 04055977218565 |
Documentation
Licencias necesarias
| Título |
|---|
| PRODUCTO REGULADO POR LA SECRETARÍA DE SALUD |
Caveolin-1 Scaffolding Domain Peptide, Cell-permeable - Calbiochem Ficha datos de seguridad (MSDS)
| Título |
|---|
Caveolin-1 Scaffolding Domain Peptide, Cell-permeable - Calbiochem Certificados de análisis
| Cargo | Número de lote |
|---|---|
| 219482 |
Referencias bibliográficas
| Visión general referencias |
|---|
| Bernatchez, P.N., et al. 2005. Proc. Natl. Acad. Sci. USA 102, 761. Williams, T.M., et al. 2004. J. Biol. Chem. 279, 51630. Gratton, J.P., et al. 2003. Cancer Cell 4, 31. Sukumaran, S.K., et al. 2002. J. Biol. Chem. 277, 50716. Liu, J., et al. 2002. J. Biol. Chem. 277, 10661. Bucci, M., et al. 2000. Nat. Med. 6, 1362. Okamoto, T., et al. 1998. J. Biol. Chem. 273, 5419. |



