Millipore Sigma Vibrant Logo
Atención: Nos hemos mudado. Los productos Merck Millipore ya no pueden adquirirse en MerckMillipore.comMás información

05-23-2151 PACAP 27 Amide, Ovine - CAS 127317-03-7 - Calbiochem

Descripción

Replacement Information

Tabla espec. clave

CAS #Empirical Formula
127317-03-7C₁₄₂H₂₂₄N₄₀O₃₉S

Products

Número de referenciaEmbalaje Cant./Env.
05-23-2151-0.5MG Frasco de vidrio .5 mg
Description
OverviewIncreases cAMP levels in a dose-dependent manner (EC50 = 4.7 nM). Increases tyrosine hydroxylase expression in chromaffin cells.
Catalogue Number05-23-2151
Brand Family Calbiochem®
SynonymsPituitary Adenylate Cyclase Activating Polypeptide, HSDGIFTDSYSRYRKQMAVKKYLAAVL-NH₂
References
ReferencesKobayashi, H., et al. 1994. Brain Res. 647, 145.
Tatsuno, I., et al. 1990. Biochem. Biophys. Res. Commun. 168, 1027.
Product Information
CAS number127317-03-7
ATP CompetitiveN
FormWhite to off-white solid
FormulationSupplied as a trifluoroacetate salt.
Hill FormulaC₁₄₂H₂₂₄N₄₀O₃₉S
Chemical formulaC₁₄₂H₂₂₄N₄₀O₃₉S
Hygroscopic Hygroscopic
ReversibleN
Sold on the basis of peptide contentY
Quality SegmentMQ100
Applications
Biological Information
Primary TargetIncreases cAMP levels
Primary Target IC<sub>50</sub>EC50 = 4.7 nM increasing cAMP levels in a dose-dependent manner
Purity≥97% by HPLC
Physicochemical Information
Cell permeableN
Peptide ContentY
Peptide SequenceH-His-Ser-Asp-Gly-Ile-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-NH₂
Dimensions
Materials Information
Toxicological Information
Safety Information according to GHS
Safety Information
Product Usage Statements
Storage and Shipping Information
Ship Code Ambient Temperature Only
Toxicity Standard Handling
Storage -20°C
Hygroscopic Hygroscopic
Do not freeze Ok to freeze
Special InstructionsFollowing reconstitution, aliquot and freeze (-20°C). Stock solutions are stable for up to 6 months at -20°C.
Packaging Information
Transport Information
Supplemental Information
Specifications
Global Trade ITEM Number
Número de referencia GTIN
05-23-2151-0.5MG 04055977226676

Documentation

PACAP 27 Amide, Ovine - CAS 127317-03-7 - Calbiochem Ficha datos de seguridad (MSDS)

Título

Ficha técnica de seguridad del material (MSDS) 

PACAP 27 Amide, Ovine - CAS 127317-03-7 - Calbiochem Certificados de análisis

CargoNúmero de lote
05-23-2151

Referencias bibliográficas

Visión general referencias
Kobayashi, H., et al. 1994. Brain Res. 647, 145.
Tatsuno, I., et al. 1990. Biochem. Biophys. Res. Commun. 168, 1027.
Ficha técnica

Note that this data sheet is not lot-specific and is representative of the current specifications for this product. Please consult the vial label and the certificate of analysis for information on specific lots. Also note that shipping conditions may differ from storage conditions.

Revision12-September-2022 JSW
SynonymsPituitary Adenylate Cyclase Activating Polypeptide, HSDGIFTDSYSRYRKQMAVKKYLAAVL-NH₂
DescriptionIncreases cAMP levels in a dose-dependent manner (EC50 = 4.7 nM). Increases tyrosine hydroxylase expression in chromaffin cells.
FormWhite to off-white solid
FormulationSupplied as a trifluoroacetate salt.
CAS number127317-03-7
Chemical formulaC₁₄₂H₂₂₄N₄₀O₃₉S
Peptide SequenceH-His-Ser-Asp-Gly-Ile-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-NH₂
Purity≥97% by HPLC
Solubility5% Acetic acid (1 mg/ml)
Storage -20°C
Hygroscopic
Do Not Freeze Ok to freeze
Special InstructionsFollowing reconstitution, aliquot and freeze (-20°C). Stock solutions are stable for up to 6 months at -20°C.
Toxicity Standard Handling
ReferencesKobayashi, H., et al. 1994. Brain Res. 647, 145.
Tatsuno, I., et al. 1990. Biochem. Biophys. Res. Commun. 168, 1027.