508512 Sigma-AldrichSNX-482 - CAS 203460-30-4 - Calbiochem
A peptidyl toxin from venom of African tarantula, Hysterocrates gigas that acts as a high affinity, reversible blocker of Cav2.3 (α1E, R-type) channels (IC₅₀ = 15-30 nM).
More>> A peptidyl toxin from venom of African tarantula, Hysterocrates gigas that acts as a high affinity, reversible blocker of Cav2.3 (α1E, R-type) channels (IC₅₀ = 15-30 nM). Less<<Productos recomendados
Descripción
Replacement Information |
---|
Tabla espec. clave
CAS # | Empirical Formula |
---|---|
203460-30-4 | C₁₉₂H₂₇₄N₅₂O₆₀S₇ |
Precios y disponibilidad
Número de referencia | Disponiblidad | Embalaje | Cant./Env. | Precio | Cantidad | |
---|---|---|---|---|---|---|
5.08512.0001 |
|
Frasco de vidrio | 10 μg |
|
— |
References | |
---|---|
References | Abitbol, K. et al. 2012. J. Physiol. 590, 2977. Newcomb, R., et al., 1998. Biochemistry. 37, 15353. |
Product Information | |
---|---|
CAS number | 203460-30-4 |
Form | White solid |
Hill Formula | C₁₉₂H₂₇₄N₅₂O₆₀S₇ |
Chemical formula | C₁₉₂H₂₇₄N₅₂O₆₀S₇ |
Quality Segment | MQ100 |
Applications |
---|
Biological Information | |
---|---|
Primary Target | Cav2.3 channels |
Primary Target IC<sub>50</sub> | 15-30 nM |
Purity | ≥98% by HPLC |
Physicochemical Information | |
---|---|
Peptide Sequence | GVDKAGCRYMFGGCSVNDDCCPRLGCHSLF→SYCAWDLTFSD (difulfid bond: 7-21, 14-26, 20-33) |
Dimensions |
---|
Materials Information |
---|
Toxicological Information |
---|
Safety Information according to GHS |
---|
Safety Information |
---|
Product Usage Statements |
---|
Packaging Information |
---|
Transport Information |
---|
Supplemental Information |
---|
Specifications |
---|
Global Trade ITEM Number | |
---|---|
Número de referencia | GTIN |
5.08512.0001 | 04055977262049 |
Documentation
SNX-482 - CAS 203460-30-4 - Calbiochem Ficha datos de seguridad (MSDS)
Título |
---|
Referencias bibliográficas
Visión general referencias |
---|
Abitbol, K. et al. 2012. J. Physiol. 590, 2977. Newcomb, R., et al., 1998. Biochemistry. 37, 15353. |