Millipore Sigma Vibrant Logo
Attention: We have moved. Merck Millipore products are no longer available for purchase on MerckMillipore.com.Learn More

MAB2291 Anti-Integrin α3 Antibody, cytoplasmic domain, clone 54B3

View Products on Sigmaaldrich.com
MAB2291
100 µg  
Purchase on Sigma-Aldrich

Offres spéciales

Aperçu

Replacement Information

Offres spéciales

Tableau de caractéristiques principal

Species ReactivityKey ApplicationsHostFormatAntibody Type
HWB, ICC, IHCMPurifiedMonoclonal Antibody
Description
Catalogue NumberMAB2291
Brand Family Chemicon®
Trade Name
  • Chemicon
DescriptionAnti-Integrin α3 Antibody, cytoplasmic domain, clone 54B3
OverviewMAB2291 is a mouse monoclonal generated to a synthetic peptide in the cytoplasmic domain of integrin alpha 3B.
Alternate Names
  • CD49c
Background InformationIntegrins are a family of heterodimeric membrane glycoproteins consisting of non-covalently associated alpha and beta subunits. More than 18 alpha and 8 beta subunits with numerous splice variant isoforms have been identified in mammals. In general, integrins function as receptors for extracellular matrix proteins. Certain integrins can also bind to soluble ligands or to counter-receptors on adjacent cells, such as the intracellular adhesion molecules (ICAMs), resulting in aggregation of cells. Signals transduced by integrins play a role in many biological processes, including cell growth, differentiation, migration and apoptosis. For integrin subunits alpha 3 and alpha 6, two cytoplasmic variants, A and B, have been identified.
References
Product Information
FormatPurified
PresentationPurified. Liquid in PBS containing 0.1% sodium azide.
Quality SegmentMQ100
Applications
ApplicationThis Anti-Integrin α3 Antibody, cytoplasmic domain, clone 54B3 is validated for use in WB, IC, IH for the detection of Integrin α3.
Key Applications
  • Western Blotting
  • Immunocytochemistry
  • Immunohistochemistry
Application NotesWestern Blotting

Immunocytochemistry

Immunohistochemistry

Optimal working dilutions must be determined by the end user.
Biological Information
ImmunogenSynthetic peptide: CTRYYQIMPKYHAVRIREEERYPPPGSTLPTKK
Epitopecytoplasmic domain
Clone54B3
ConcentrationPlease refer to the Certificate of Analysis for the lot-specific concentration.
HostMouse
SpecificityAnti-Integrin alpha 3B recognizes the cytoplasmic domain of integrin alpha 3B. Integrin alpha 3B is present in the microvascular structures in brain and heart.

SPECIES REACTIVITIES:

Although untested, a broad species reactivity is expected due to the conserved nature of the epitope.
IsotypeIgG1
Species Reactivity
  • Human
Antibody TypeMonoclonal Antibody
Entrez Gene Number
Entrez Gene SummaryITGA3 encodes the integrin alpha 3 chain. Integrins are heterodimeric integral membrane proteins composed of an alpha chain and a beta chain. Alpha chain 3 undergoes post-translational cleavage in the extracellular domain to yield disulfide-linked light and heavy chains that join with beta 1 to form an integrin that interacts with many extracellular-matrix proteins. The alpha 3 beta 1 integrin is known variously as: very late (activation) antigen 3 ('VLA-3'), very common antigen 2 ('VCA-2'), extracellular matrix receptor 1 ('ECMR1'), and galactoprotein b3 ('GAPB3').
Gene Symbol
  • ITGA3
  • FRP-2
  • GAP-B3
  • CD49c
  • FLJ34704
  • MSK18
  • VL3A
  • VLA3a
  • GAPB3
  • CD49C
  • VCA-2
  • FLJ34631
UniProt Number
UniProt SummaryFUNCTION: SwissProt: P26006 # Integrin alpha-3/beta-1 is a receptor for fibronectin, laminin, collagen, epiligrin, thrombospondin and CSPG4. Alpha- 3/beta-1 may mediate with LGALS3 the stimulation by CSPG4 of endothelial cells migration.
SIZE: 1066 amino acids; 118698 Da
SUBUNIT: Heterodimer of an alpha and a beta subunit. The alpha subunit is composed of an heavy and a light chain linked by a disulfide bond. Alpha-3 associates with beta-1. Interacts with HPS5.
SUBCELLULAR LOCATION: Membrane; Single-pass type I membrane protein.
TISSUE SPECIFICITY: Isoform alpha-3A is widely expressed. Isoform alpha-3B is expressed in brain and heart. In brain, both isoforms are exclusively expressed on vascular smooth muscle cells, whereas in heart isoform alpha-3A is strongly expressed on vascular smooth muscle cells, isoform alpha-3B is detected only on endothelial vein cells.
PTM: Isoform alpha-3A, but not isoform alpha-3B, is phosphorylated on serine residues. Phosphorylation increases after phorbol 12- myristate 13-acetate stimulation.
SIMILARITY: SwissProt: P26006 ## Belongs to the integrin alpha chain family. & Contains 7 FG-GAP repeats.
Physicochemical Information
Dimensions
Materials Information
Toxicological Information
Safety Information according to GHS
Safety Information
Product Usage Statements
Usage Statement
  • Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Storage and Shipping Information
Storage ConditionsStore at 2-8°C, or in small aliquots at -20°C.
Packaging Information
Material Size100 µg
Transport Information
Supplemental Information
Specifications
Global Trade ITEM Number
Référence GTIN
MAB2291 04053252466403

Produits & Applications associés

Related Products

Référence Description
AB1920 Anti-Integrin α3 Antibody
MAB1952Z Anti-Integrin α3 Antibody, clone P1B5, azide free
MAB1992 Anti-Integrin α3β1 Antibody, clone M-KID2
MAB2056 Anti-Integrin α3 Antibody, clone ASC-1
MAB2056Z Anti-Integrin α3 Antibody, clone ASC-1 (Azide Free)
MAB2057 Anti-Integrin α3 Antibody, clone ASC-6
MAB2290 Anti-Integrin α3 Antibody, cytoplasmic domain, clone 29A3

Catégories

Life Science Research > Antibodies and Assays > Primary Antibodies