Skip to Content
Merck

HPA039057

Anti-MCRS1 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):

Anti-Icp22bp, Anti-Ino80q, Anti-Mcrs2, Anti-Microspherule protein 1, Anti-Msp58, Anti-P78

Sign In to View Organizational & Contract Pricing.

Select a Size


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41
Human Protein Atlas Number:
Conjugate:
unconjugated
Clone:
polyclonal
Application:
IF, IHC
Citations:
8
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist

biological source

rabbit

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human, rat, mouse

technique(s)

immunoblotting: 0.04-0.4 μg/mL, immunofluorescence: 0.25-2 μg/mL, immunohistochemistry: 1:1000-1:2500

immunogen sequence

HPDAFYLARTAKALQAHWQLMKQYYLLEDQTVQPLPKGDQVLNFSDAEDLIDDSKLKDMRDEVLEHELMVADRRQKREIRQLEQELHKWQVLVD

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Quality Level

Gene Information

human ... MCRS1(10445)

General description

Microspherule protein 1 (MCRS1) is a nucleolar protein and also acts as an oncogene. The gene is located on human chromosome 12q13.

Immunogen

microspherule protein 1 recombinant protein epitope signature tag (PrEST)

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
Anti-MCRS1 antibody produced in rabbit has been used in immunohistochemistry.

Biochem/physiol Actions

Microspherule protein 1 (MCRS1) contributes to several cellular processes, such as growth, migration, senescence and transformation. It is overexpressed in non-small cell lung cancer (NSCLC) and enhances the growth of cancerous cells. It suppresses telomerase activity by blocking transcriptional element-interacting factor (TEIF)-mediated transactivation of the hTERT (telomerase reverse transcriptase) promoter. The protein plays a critical role in the proliferation and apoptosis of hepatocellular carcinoma (HCC) cells.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Physical form

Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Other Notes

Corresponding Antigen APREST81232

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class

10 - Combustible liquids

wgk

WGK 1

flash_point_f

Not applicable

flash_point_c

Not applicable


Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Expression of 58-kD microspherule protein (MSP58) is highly correlated with PET imaging of tumor malignancy and cell proliferation in glioma patients
Lin W, et al.
Cellular Physiology and Biochemistry, 38(2), 635-645 (2016)
Identification and characterization of nuclear and nucleolar localization signals in 58-kDa microspherule protein (MSP58)
Yang CP, et al.
Journal of Biomedical Science, 22(1), 33-33 (2015)
The candidate oncogene (MCRS1) promotes the growth of human lung cancer cells via the miR-155-Rb1 pathway
Liu M, et al.
Journal of Experimental & Clinical Cancer Research, 34(1), 121-121 (2015)
Liang-Han Wang et al.
Diagnostics (Basel, Switzerland), 12(6) (2022-06-25)
Gastric cancer is the fifth most common cancer worldwide and the third most common cause of cancer-related deaths. Surgery remains the first-choice treatment. Chemotherapy is considered in the middle and advanced stages, but has limited success. Microspherule protein 1 (MCRS1
Analysis of 20 genes at chromosome band 12q13: RACGAP1 and MCRS1 overexpression in nonsmall-cell lung cancer
Benavides M
Genes Chromosomes Cancer, 52(3), 635-645 (2013)

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service