biological source
rabbit
Quality Segment
conjugate
unconjugated
antibody form
affinity isolated antibody
antibody product type
primary antibodies
clone
polyclonal
product line
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
human
enhanced validation
independent
orthogonal RNAseq
Learn more about Antibody Enhanced Validation
technique(s)
immunoblotting: 0.04-0.4 μg/mL, immunohistochemistry: 1:1000-1:2500
immunogen sequence
NEDHKRCVDAVSPSAVQTAACNQDAESQKFRWVSESQIMSVAFKLCLGVPSKTDWVAITLYACDSKSEFQKWECKNDTLLGIKGEDLFFNYGNRQEKNIMLYKGSGLWSRWKIYG
UniProt accession no.
shipped in
wet ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... MRC1(4360)
General description
Mannose receptor, C type 1 (MRC1) is a trans-membrane glycoprotein, that is expressed at high levels in the M2 macrophages. This functional gene has 30 exons and is of 101.74 kb. MRC1 consists of a ricin b-type lectin domain (RICIN), a fibronectin type-II domain (FN2), 8 C-type lectin-like domains (CTLDs), a single transmembrane domain (TM) and a short cytosolic domain. It is also expressed on endothelial cells and plasma membrane. This gene is located on human chromosome 10p12.
Immunogen
Macrophage mannose receptor 1 precursor recombinant protein epitope signature tag (PrEST)
Application
Anti-MRC1 antibody has been used:
- in immunofluorescence Ab staining
- in confocal microscopy
- in immunohistochemical staining
Biochem/physiol Actions
Mannose receptor, C type 1 (MRC1) encodes for human mannose receptor (MR) and is a member of the C-type lectin receptors family. It recognizes and binds to Mycobacterium tuberculosis by the extracellular structure. It plays a role in antigen-presenting and maintaining a stable internal environment. It plays a critical role in controlling immune response and in regulating allergen induced allergic responses in asthma. This gene along with HSP70 family members through the receptor cytoplasmic tail may contribute to MR trafficking in macrophages.
Mannose receptor, C type 1 (MRC1) is involved in phagocytosis.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:
Every Prestige Antibody is tested in the following ways:
- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide
Other Notes
Corresponding Antigen APREST86249
Legal Information
Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Still not finding the right product?
제품 선택 도구}를 사용하여 선택의 폭을 좁혀보세요.
저장 등급
10 - Combustible liquids
wgk
WGK 1
flash_point_f
Not applicable
flash_point_c
Not applicable
ppe
Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)