Skip to Content
Merck

860381P

Avanti

14:0 PG-d54

Avanti Research - A Croda Brand

Synonym(s):

1,2-dimyristoyl-d54-sn-glycero-3-[phospho-rac-(1-glycerol)] (sodium salt)

Sign In to View Organizational & Contract Pricing.

Select a Size


About This Item

Empirical Formula (Hill Notation):
C34H12O10PNaD54
CAS Number:
Molecular Weight:
743.18
MDL number:
UNSPSC Code:
12352100
NACRES:
NA.25
Assay:
>99% (TLC)
Form:
powder
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist

Product Name

14:0 PG-d54, Avanti Research - A Croda Brand 860381P, powder

SMILES string

[H][C@@](COP([O-])(OCC(O)CO)=O)(OC(C([2H])([2H])C([2H])([2H])C([2H])([2H])C([2H])([2H])C([2H])([2H])C([2H])([2H])C([2H])([2H])C([2H])([2H])C([2H])([2H])C([2H])([2H])C([2H])([2H])C([2H])([2H])C([2H])([2H])[2H])=O)COC(C([2H])([2H])C([2H])([2H])C([2H])([2H])

assay

>99% (TLC)

form

powder

packaging

pkg of 1 × 10 mg (860381P-10mg), pkg of 1 × 100 mg (860381P-100mg)

manufacturer/tradename

Avanti Research - A Croda Brand 860381P

shipped in

dry ice

storage temp.

−20°C

General description

14:0 PG-d54 is a deuterated phosphoglycerol (PG) wherein 54 protons of dimyristoyl are replaced by deuterium.
Deuterated fatty acids experience exchange of the deuteriums on the alpha carbon to the carbonyl, i.e., C2 position, and will therefore be a mixture of compounds that are fully deuterated and partially deuterated at that position.

Application

14:0 PG-d54 may be used to study the unspecific interaction of a phospholipid membrane with endotoxins.

Packaging

5 mL Amber Glass Screw Cap Vial (860381P-100mg)
5 mL Amber Glass Screw Cap Vial (860381P-10mg)

Legal Information

Avanti Research is a trademark of Avanti Polar Lipids, LLC

Storage Class

11 - Combustible Solids

wgk

WGK 3


Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

It looks like we've run into a problem, but you can still download Certificates of Analysis from our Documents section.

If you need assistance, please contact Customer Support

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Lipopolysaccharide-binding protein-mediated interaction of lipid A from different origin with phospholipid membranes Invited Lecture
Gutsmann T, et al.
Physical Chemistry Chemical Physics, 2(20), 4521-4528 (2000)
Randi Nordström et al.
Journal of colloid and interface science, 562, 322-332 (2019-12-20)
In the present study, lipid membrane interactions of anionic poly(ethyl acrylate-co-methacrylic acid) (MAA) microgels as carriers for the cationic antimicrobial peptide LL-37 ([LL-37, 37 aa]) were investigated. In doing so, neutron reflectometry (NR), Fourier-transform infrared spectroscopy with attenuated total reflection (FTIR-ATR), zeta
Chris Miranda et al.
Langmuir : the ACS journal of surfaces and colloids, 34(39), 11759-11771 (2018-09-11)
SP-B63-78, a lung surfactant protein fragment, and magainin 2, an antimicrobial peptide, are amphipathic peptides with the same overall charge but different biological functions. Deuterium nuclear magnetic resonance has been used to compare the interactions of these peptides with dispersions
Nicole Harmouche et al.
Biophysical journal, 115(6), 1033-1044 (2018-09-10)
A synergistic enhancement of activities has been described for the amphipathic cationic antimicrobial peptides magainin 2 and PGLa when tested in antimicrobial assays or in biophysical experiments using model membranes. In the presence of magainin 2, PGLa changes from an

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service