Skip to Content
Merck

AV100839

Anti-HLX1 antibody produced in rabbit

IgG fraction of antiserum

Synonym(s):

Anti-H2.0-like homeobox 1 (Drosophila)

Sign In to View Organizational & Contract Pricing.

Select a Size


About This Item

NACRES:
NA.41
UNSPSC Code:
12352203
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist

Product Name

Anti-HLX1 antibody produced in rabbit, IgG fraction of antiserum

biological source

rabbit

conjugate

unconjugated

antibody form

IgG fraction of antiserum

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

51 kDa

species reactivity

human

concentration

0.5 mg - 1 mg/mL

technique(s)

immunofluorescence: suitable
western blot: suitable

NCBI accession no.

shipped in

wet ice

storage temp.

−20°C

Quality Level

Gene Information

human ... HLX1(3142)

Application

Anti-HLX1 antibody produced in rabbit is suitable for western blotting at a concentration of 1 μg/ml.

Biochem/physiol Actions

The expression of HLX1 transcription factor is critical for the development of early life immune development. It influences the IL-5 and IL-13 secretion and contributes to Th2-mediated immune responses and development of childhood asthma.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Immunogen

Synthetic peptide directed towards the middle region of human HLX1

Other Notes

Synthetic peptide located within the following region: PGPYAVLTKDTMPQTYKRKRSWSRAVFSNLQRKGLEKRFEIQKYVTKPDR

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class

10 - Combustible liquids

wgk

WGK 3

flash_point_f

Not applicable

flash_point_c

Not applicable


Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Vera Isabel Casaca et al.
PloS one, 7(1), e31069-e31069 (2012-02-04)
TBX21 (T cell specific T-box transcription factor) and HLX1 (H.20-like homeobox 1) are crucial transcription factors of T(H)1-cells, inducing their differentiation and suppressing T(H)2 commitment, particularly important for early life immune development. This study investigated the influence of TBX21 and
Kathrin Suttner et al.
The Journal of allergy and clinical immunology, 123(1), 82-88 (2008-11-29)
Major transcription factors controlling T(H)1 and T(H)2 development, such as T-box transcription factor and GATA3, might be centrally involved in asthma and atopic diseases. Only recently, the homeobox transcription factor H.20-like homeobox 1 (HLX1), interacting closely with T-box transcription factor
Peng Hou et al.
Cell cycle (Georgetown, Tex.), 11(2), 286-295 (2011-12-23)
Although BRAF(V600E) is well known to play an important role in the tumorigenesis of melanoma, its molecular mechanism, particularly the epigenetic aspect, has been incompletely understood. Here, we investigated the role of BRAF(V600E) signaling in altering gene methylation in the
Peng Hou et al.
Endocrine-related cancer, 18(6), 687-697 (2011-09-23)
The BRAF V600E mutation plays an important role in the tumorigenesis of papillary thyroid cancer (PTC). To explore an epigenetic mechanism involved in this process, we performed a genome-wide DNA methylation analysis using a methylated CpG island amplification (MCA)/CpG island

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service