Saltar al contenido
Merck

374087

Anti-Heme Oxygenase-1 Mouse mAb (HO-1-1)

liquid, clone HO-1-1, Calbiochem®

Sinónimos:

Anti-HO-1, Anti-Hsp32

Iniciar sesión para ver los precios por organización y contrato.

Seleccione un Tamaño

Acerca de este artículo

NACRES:
NA.41
UNSPSC Code:
12352203

Documentos clave

Ver Toda la documentación
Servicio técnico
¿Necesita ayuda? Nuestro equipo de científicos experimentados está aquí para ayudarle.
Permítanos ayudarle
Servicio técnico
¿Necesita ayuda? Nuestro equipo de científicos experimentados está aquí para ayudarle.
Permítanos ayudarle

Nombre del producto

Anti-Heme Oxygenase-1 Mouse mAb (HO-1-1), liquid, clone HO-1-1, Calbiochem®

biological source

mouse

antibody form

purified antibody

antibody product type

primary antibodies

clone

HO-1-1, monoclonal

form

liquid

contains

≤0.1% sodium azide as preservative

species reactivity

human, rat, canine, monkey, mouse, bovine

manufacturer/tradename

Calbiochem®

storage condition

OK to freeze
avoid repeated freeze/thaw cycles

dilution

(Immunoblotting (4 µg/mL, chemiluminescence)
Immunocytochemistry (1:1000)
Immunoprecipitation (20 µg/mL))

isotype

IgG1

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Quality Level

100

Gene Information

bovine ... Hmox1(513221)
dog ... Hmox1(442987)
human ... HMOX1(3162)
mouse ... Hmox1(15368)
rat ... Hmox1(24451)
rhesus monkey ... Hmox1(719266)

Application

Immunoblotting (4 µg/ml, chemiluminescence)

Immunocytochemistry (1:1000)

Immunoprecipitation (20 µg/ml)

Disclaimer

Toxicity: Standard Handling (A)

General description

Anti-Heme Oxygenase-1, mouse monoclonal, clone HO-1-1, recognizes the ~32 kDa HO-1 in a variety of species. It is validated for use in Western blotting, immunocytochemistry, and immunoprecipitation.
Protein G purified mouse monoclonal antibody. Recognizes the ~32 kDa heme oxygenase (HO-1) protein.
Recognizes the ~32 kDa HO-1 protein.

Immunogen

Human
a synthetic peptide (MERPQPDSMPQDLSEALKEATKEVHTQAEN) corresponding to amino acids 1-30 of human HO-1 prepared as a four-branched multiple antigen peptide

Other Notes

Does not cross-react with HO-2. Variables associated with assay conditions will dictate the proper working dilution.
Yoshida, T., et al. 1988. Eur. J. Biochem. 171, 457.
Maines, M.D. 1988. FASEB J.2, 2557.
Trakshel, G.M., et al. 1986 J. Biol. Chem.261, 11131.

Packaging

Please refer to vial label for lot-specific concentration.

Physical form

In PBS, 50% glycerol.

Preparation Note

Following initial thaw, aliquot and freeze (-20°C).

Legal Information

CALBIOCHEM is a registered trademark of Merck KGaA, Darmstadt, Germany

¿No encuentra el producto adecuado?  

Pruebe nuestro Herramienta de selección de productos.

Clase de almacenamiento

10 - Combustible liquids

wgk

WGK 1

Certificados de análisis (COA)

Busque Certificados de análisis (COA) introduciendo el número de lote del producto. Los números de lote se encuentran en la etiqueta del producto después de las palabras «Lot» o «Batch»

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

László Potor et al.
Oxidative medicine and cellular longevity, 2018, 3812568-3812568 (2018-03-22)
The infiltration of red blood cells into atheromatous plaques is implicated in atherogenesis. Inside the lesion, hemoglobin (Hb) is oxidized to ferri- and ferrylHb which exhibit prooxidant and proinflammatory activities. Cystathione gamma-lyase- (CSE-) derived H2S has been suggested to possess
Steven J T Jackson et al.
Food and chemical toxicology : an international journal published for the British Industrial Biological Research Association, 60, 431-438 (2013-08-14)
Curcumin, a component of turmeric spice that imparts flavor and color to curry, is thought to possess anti-inflammatory and antioxidant properties in biological tissues. However, while such efficacies have been described in the context of carcinogenesis, the impact of curcumin
Qian Sun et al.
Experimental and therapeutic medicine, 21(3), 190-190 (2021-01-26)
The nuclear erythroid 2-related factor 2 (NRF2)/antioxidant response element (ARE) pathway has been shown to provide strong protection against oxidative stress injury induced by renal ischemia-reperfusion (IR). However, the endogenous regulatory mechanism of the NRF2/ARE pathway in renal IR injury
Ye Tian et al.
PloS one, 18(1), e0279964-e0279964 (2023-01-07)
Sepsis associated encephalopathy (SAE) is a common but poorly understood complication during sepsis. Currently, there are no preventive or therapeutic agents available for this neurological disorder. The present study was designed to determine the potential protective effects of β-patchoulene (β-PAE)
N V Srikanth Vallabani et al.
Mutagenesis, 34(3), 265-277 (2019-07-05)
Zinc oxide nanoparticles (ZnO NPs) with their wide range of consumer applications in day-to-day life received great attention to evaluate their effects in humans. This study has been attempted to elucidate the DNA damage response mechanism in a dermal model

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico